DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG11529

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:249 Identity:73/249 - (29%)
Similarity:109/249 - (43%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EFPHMARL-GRRPDPSSRADW----FCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLD 137
            :||:...| |::.       |    .|||.|:.:|::|||.||           .:|...:|...
  Fly    40 KFPYQVMLIGKQL-------WRKRILCGGTLLDKRWILTAGHC-----------TMGVTHYDVYL 86

  Fly   138 EDAAPRDYMVAG--------YIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQ---DER 191
            ...:..|..|:|        :|.|..:......:||.||||.:.|.|.....||.||.:   |:.
  Fly    87 GTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQF 151

  Fly   192 SSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQ 256
            :..|.:|.|||:. :.:..|..:...:|:...|..|       .:|:.....|  .:|......:
  Fly   152 AGMSVVASGWGAM-VEMTNSDSMQYTELKVISNAEC-------AQEYDVVTSG--VICAKGLKDE 206

  Fly   257 DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309
            ..|.|||||||::...:     :||||||.|.:.| ...|||.:|||..||.||
  Fly   207 TVCTGDSGGPLVLKDTQ-----IVVGITSFGPADGCETNIPGGFTRVTHYLDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 73/249 (29%)
Tryp_SPc 68..309 CDD:214473 71/247 (29%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 73/249 (29%)
Tryp_SPc 37..255 CDD:214473 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.