DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Jon66Ci

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_729372.1 Gene:Jon66Ci / 38952 FlyBaseID:FBgn0035886 Length:260 Species:Drosophila melanogaster


Alignment Length:304 Identity:82/304 - (26%)
Similarity:114/304 - (37%) Gaps:85/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDP 91
            |.|.|.|:..|..:.     |...|.||.|           |..|:||:..:.|:...||     
  Fly    12 VASASAYESVVHPKD-----LSKVAKIEGR-----------ITNGYPAEEGKAPYTVGLG----- 55

  Fly    92 SSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGY 156
             ....|:|||.:||..:||||.||:..:                          .|..|......
  Fly    56 -FSGGWWCGGSIISNEWVLTAEHCIGGD--------------------------AVTVYFGATWR 93

  Fly   157 EDPQFYH-------------DIGLVKLTEAVVFDLYKHPACLPFQDERSSDS----FIAVGWGST 204
            .:.||.|             ||.|:::.. |.|....:...||..::|.:|.    .:|.|||.|
  Fly    94 TNAQFTHWVGSGNFITHGSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGT 157

  Fly   205 --GLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPL 267
              |..|....|.  |.||...|..|       ...:..|..|:|.:||.....:.||.|||||||
  Fly   158 YDGSPLPDYLQC--VDLQIIHNSEC-------ASYYGTGTVGDNIICVRVVDGKGTCGGDSGGPL 213

  Fly   268 LMYHREYPCMYVVVGITS--AGLSCGSPGIPGIYTRVYPYLGWI 309
            :.:...     .:||:|:  :|..| ..|.|..:.||..:|.||
  Fly   214 VTHDGS-----KLVGVTNWVSGAGC-QAGHPAGFQRVTYHLDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 72/263 (27%)
Tryp_SPc 68..309 CDD:214473 70/261 (27%)
Jon66CiNP_729372.1 Tryp_SPc 36..251 CDD:214473 71/273 (26%)
Tryp_SPc 37..254 CDD:238113 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.