DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG10469

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:311 Identity:82/311 - (26%)
Similarity:130/311 - (41%) Gaps:69/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIVSLACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPA 74
            |||..:.||||:     .||..                                    |:.|..|
  Fly     7 LIVQFSLVFGQE-----TGSLR------------------------------------IMNGTAA 30

  Fly    75 QPREFPHMARL-----GRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEV--NVVRLGEL- 131
            :.::.|:...|     |.:.:|:     .|||.::|.|:::||||||:..:..:  .::.:|:: 
  Fly    31 KAKQLPYQVGLLCYFEGSKDEPN-----MCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVGKVK 90

  Fly   132 DFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDER-SSDS 195
            .||. .|....|.|.    |.|..::.....:||.|:||.:.:.|:.|..||.||...:. :...
  Fly    91 SFDD-KEIVVNRSYT----IVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSAKKTYTGRK 150

  Fly   196 FIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCN 260
            .|..|||.|...| ||..|..::.....|..|::...:|:....:....|..:|:.|:... .|.
  Fly   151 AIISGWGLTTKQL-PSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL-PCR 213

  Fly   261 GDSGGPLLMYHREYPCMYVVVGITSAGL--SCGSPGIPGIYTRVYPYLGWI 309
            ||||||:::....    ..:|||.|.|.  .| ...:|.:.|||..||.||
  Fly   214 GDSGGPMVLDDGS----RTLVGIVSHGFDGEC-KLKLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 73/253 (29%)
Tryp_SPc 68..309 CDD:214473 71/251 (28%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/288 (25%)
Tryp_SPc 24..260 CDD:238113 73/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.