DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:283 Identity:79/283 - (27%)
Similarity:109/283 - (38%) Gaps:67/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPG-ASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLT 111
            ||. .:||.|           |..|..|...:||:...|.   ..|:...|:|||.:|...:|||
  Fly    30 LPAVTNIEGR-----------ITNGKTATSGQFPYQVGLS---FASTSGSWWCGGSIIDNTWVLT 80

  Fly   112 AAHCLESERGEVNV-----VRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLT 171
            |||| .|....|.:     ||.......::..|         .::.|..|......:||.|:| |
  Fly    81 AAHC-TSGASAVTIYYGATVRTSAQLVQTVSAD---------NFVQHASYNSIVLRNDISLIK-T 134

  Fly   172 EAVVF----DLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKL----------QRY 222
            ..|.|    :..:.||........:....||.|||.|..:....|..|:.::          ..|
  Fly   135 PTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTY 199

  Fly   223 GNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAG 287
            |:.|..                ||.:||.:.....||||||||||::....     .::|:||..
  Fly   200 GSLVAT----------------NNVICVATPNKVSTCNGDSGGPLVLVSDS-----KLIGVTSFV 243

  Fly   288 LSCG-SPGIPGIYTRVYPYLGWI 309
            .|.| ..|.|..:|||..||.||
  Fly   244 SSAGCESGAPAGFTRVTSYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 74/262 (28%)
Tryp_SPc 68..309 CDD:214473 72/260 (28%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 73/272 (27%)
Tryp_SPc 40..269 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.