DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and KLKB1

DIOPT Version :10

Sequence 1:NP_651663.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:263 Identity:81/263 - (30%)
Similarity:121/263 - (46%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DN--CRSYTPL-IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLES-E 119
            ||  |.:.|.. ||||..:...|:|....|..:......   .|||.||..::|||||||.:. .
Human   390 DNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRH---LCGGSLIGHQWVLTAAHCFDGLP 451

  Fly   120 RGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPAC 184
            ..:|..:..|.|:...:.:| .|.. .:...|.|..|:..:..|||.|:||...:.:..::.|.|
Human   452 LQDVWRIYSGILNLSDITKD-TPFS-QIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPIC 514

  Fly   185 LPFQDERSS--DSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKK-----LLTRQVEEFPRGF 242
            ||.:.:.|:  .:....|||.:....:....|.||.:....|..|:|     .:|:::       
Human   515 LPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRM------- 572

  Fly   243 DGNNQLCVG-SEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYL 306
                 :|.| .|..:|.|.|||||||:..|..   |:.:|||||.|..|.....||:||:|..|:
Human   573 -----VCAGYKEGGKDACKGDSGGPLVCKHNG---MWRLVGITSWGEGCARREQPGVYTKVAEYM 629

  Fly   307 GWI 309
            .||
Human   630 DWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_651663.1 Tryp_SPc 68..312 CDD:238113 77/251 (31%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 75/249 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.