DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG15873

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:350 Identity:85/350 - (24%)
Similarity:129/350 - (36%) Gaps:116/350 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWRLFSQLIVSLACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYT 65
            |:|..:|..||:|.:.   ...|:.|:|..|       :|..|.                     
  Fly     1 MQILTVFLGLILSTSL---SDADLGVIGDIS-------DETFEM--------------------- 34

  Fly    66 PLIVGGH-PAQPREFPHMARLGRRPDPSSRAD-WFCGGVLISERFVLTAAHCL-ESERGEVN--- 124
             ||.||: |...|...|:..:..:.....|.| .||.|||:|.|.|||||||| :..:..:|   
  Fly    35 -LISGGYKPKSNRLSRHVVSIRTKNYVRHRGDNHFCSGVLVSSRAVLTAAHCLTDRYKASMNPRG 98

  Fly   125 -------VVRLG---ELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLY 179
                   :.||.   |.||.|:|.           .:.||.||..: .:|:.:::|:|.|  ...
  Fly    99 IRVVFGHITRLAVYDESDFRSVDR-----------LVVHPEYERYK-KNDLAILRLSERV--QSS 149

  Fly   180 KHPACLPFQDERSS-----DSFIAVGWGS-------------TGLALKPSAQLLKVKLQRYGNWV 226
            .|.. ||....:::     |:.|.:|||.             ..:.|:|.:             :
  Fly   150 NHDV-LPLLMRKTANVTYGDTCITLGWGQIYQHGPYSNELVYLDVILRPPS-------------L 200

  Fly   227 CKKLLTRQVEEFPRGFDGNNQLC---VGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL 288
            |:|....        |..::.:|   ||..|   .|.||.|||||       |...:.|:....:
  Fly   201 CQKHYDT--------FTADHNVCTEPVGESM---NCAGDMGGPLL-------CKGALFGLIGGHM 247

  Fly   289 SCGSPGIPGIYTRVYPYLGWIARTL 313
            .|.........:.:| |..||..|:
  Fly   248 GCAGGKAMKFLSFLY-YKDWILLTI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 71/280 (25%)
Tryp_SPc 68..309 CDD:214473 69/277 (25%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 66/259 (25%)
Tryp_SPc 59..250 CDD:238113 60/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.