DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30283

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:112/256 - (43%) Gaps:41/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132
            |:|||.|.....|.||.:      .....:.|||.||:.|||||:|||:.:  ||:. ||||   
  Fly    43 ILGGHNAPVASAPWMAMV------MGEGGFHCGGTLITNRFVLTSAHCIAN--GELK-VRLG--- 95

  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQ------DER 191
              .|:.:|..:.:.|.....|..|...|  ||:.|::|.:.|.:.....|.||...      ||.
  Fly    96 --VLEREAEAQKFAVDAMFVHTDYYFDQ--HDLALLRLAKRVHYSDNISPICLLLDPLVKNIDEH 156

  Fly   192 SSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQ 256
            .. .|...|||.|. :...|..|.|..|.......|.|       ::|......|.:|..|..| 
  Fly   157 IV-KFRTYGWGKTE-SRSSSRMLQKTSLFNLHRSECAK-------QYPHQQINRNHICAESANA- 211

  Fly   257 DTCNGDSGGPL---LMYHREYPCMYVVVGITSAG-LSCGSPGIPGIYTRVYPYLGWIARTL 313
            :||||||||||   :.|  ::..|....|:||.| ..|..   ..::|.|..:|.||..|:
  Fly   212 NTCNGDSGGPLTAIVTY--DHVQMVFQFGVTSFGHADCSK---ATVFTNVMTHLDWIVNTV 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/253 (32%)
Tryp_SPc 68..309 CDD:214473 79/250 (32%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 79/250 (32%)
Tryp_SPc 43..266 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.