DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG4927

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:271 Identity:118/271 - (43%)
Similarity:151/271 - (55%) Gaps:24/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESE 119
            :.|..:||: ||.||||..|..||||.||.||:|...||:.||.||.::|..:||||||||||:.
  Fly    93 NEIRTSCRT-TPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETS 156

  Fly   120 R-----------GEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGY-EDPQF---YHDIGLVK 169
            .           |...||||||||::|..:||.|:|:.|..|:.||.| ||...   .:||.:|:
  Fly   157 ETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVE 221

  Fly   170 LTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQ 234
            |.....|..|..|||||...........|.|||:|..:...|:.||||.|.||....|.:.|..:
  Fly   222 LEMEATFSEYVAPACLPLDGGNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHK 286

  Fly   235 VEEFPRGFDGNNQLCVGS-EMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGI 298
            :       |...|||.|| ..:.|||.||||||:.:.|..|.|:..|:||||.||.||..|:|.:
  Fly   287 I-------DVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQGLPSV 344

  Fly   299 YTRVYPYLGWI 309
            ||:|:.|..||
  Fly   345 YTKVHLYTDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 113/258 (44%)
Tryp_SPc 68..309 CDD:214473 111/256 (43%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 113/258 (44%)
Tryp_SPc 105..355 CDD:214473 111/256 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.