DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG12133

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:308 Identity:100/308 - (32%)
Similarity:129/308 - (41%) Gaps:69/308 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GFLLPGASIESRIIDNCRSYTP--LIVGGHPAQPREFPHMARLG-------RRPDPSSRADWFCG 100
            |..||    :||:   |....|  .||||..||..:||....||       :||.|      .|.
  Fly    44 GDKLP----DSRV---CGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSP------MCA 95

  Fly   101 GVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDA----------APR--DYMVAGYIAH 153
            |.||:.|:||||||||......|..|||||.|.:: |.|.          ||.  |..|...:.|
  Fly    96 GSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTEN-DPDYTWLPNGAKIWAPAHVDIDVDLRVPH 159

  Fly   154 PGY--EDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSF------IAVGWGSTGLALKP 210
            ..|  .:.:.|:||.|::|...|.:.|...|.|:....|.|:.||      || |||.:||..|.
  Fly   160 EQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIA-GWGDSGLQQKS 223

  Fly   211 --------SAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPL 267
                    |.......|.||..    .|:.:.::....|:||.           ||..||||.||
  Fly   224 TVLRQGTISGMSPDECLNRYPT----LLVDKDIQICAMGWDGT-----------DTGLGDSGSPL 273

  Fly   268 L-MYHREYPCMYVVVGITSAGLSCGSPGI-PGIYTRVYPYLGWIARTL 313
            : ...|.....|.:.||||.|....|.|. |.:||:...|..||.:.:
  Fly   274 MASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 93/280 (33%)
Tryp_SPc 68..309 CDD:214473 91/277 (33%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 93/280 (33%)
Tryp_SPc 62..317 CDD:214473 91/277 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.