DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Jon44E

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:308 Identity:83/308 - (26%)
Similarity:128/308 - (41%) Gaps:53/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLIVSLACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGA-SIESRIIDNCRSYTPLIVGGH 72
            :|.|.|||:  ......||.|.|.....|.:        :|.| .||.|           |..|:
  Fly     2 KLFVFLACL--AVASAGVVPSESARAVPVKD--------MPRAGKIEGR-----------ITNGY 45

  Fly    73 PAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLD 137
            ||...:.|::..|.     .:...::|||.:|...:|||||||..|....:       :.|.:..
  Fly    46 PAYEGKIPYIVGLS-----FNDGGYWCGGSIIDHTWVLTAAHCTNSANHVL-------IYFGASF 98

  Fly   138 EDAAPRDYMV--AGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDS---FI 197
            ...|...:.|  :..|.||.:.| ...:||.|:::.....:.|........:.|..:|.|   .:
  Fly    99 RHEAQYTHWVSRSDMIQHPDWND-FLNNDIALIRIPHVDFWSLVNKVELPSYNDRYNSYSGWWAV 162

  Fly   198 AVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGD 262
            |.|||.|......|..|..|.:|...|..|:..       :...:..:|.:|:.::..:.:|:||
  Fly   163 ASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNY-------YGSNYITDNTICINTDGGKSSCSGD 220

  Fly   263 SGGPLLMYHREYPCMYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309
            |||||:::....     :|||.|.|...| :.|.|..:|||..||.||
  Fly   221 SGGPLVLHDNNR-----IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 68/248 (27%)
Tryp_SPc 68..309 CDD:214473 66/246 (27%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 67/258 (26%)
Tryp_SPc 41..266 CDD:238113 68/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.