DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and try-9

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:287 Identity:66/287 - (22%)
Similarity:107/287 - (37%) Gaps:86/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLE 117
            ::.||.|...|:..   ||:.....||.....                |.|:|...::||||.: 
 Worm     1 MKKRISDGSGSFRN---GGNKFSENEFVQHGT----------------GTLVSPWHIVTAAHLI- 45

  Fly   118 SERGEVNVVRLGELDFDSLDEDAAPRDY--MVA-------------------------------- 148
                .::...|.:.|..:|.|....|||  .||                                
 Worm    46 ----GISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIR 106

  Fly   149 -GYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDE--RSSDSFIAVGWGSTGLALKP 210
             ||:. .|..|.:.::||.:.:|.|.:.|.....|||||...:  |..::    |:...|....|
 Worm   107 KGYVG-DGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRET----GYKLFGYGRDP 166

  Fly   211 SAQLLKV-KLQRYGNWV--CKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHR 272
            |..:|:. ||:...::|  |.       ::||.|    ...|..:.....:|:||||..::. ..
 Worm   167 SDSVLESGKLKSLYSFVAECS-------DDFPYG----GVYCTSAVNRGLSCDGDSGSGVVR-TS 219

  Fly   273 EYPCMYVVVGITSAGLSCGSPGIPGIY 299
            :...:.|:||:.|||:.|     |.:|
 Worm   220 DTRNVQVLVGVLSAGMPC-----PELY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 62/272 (23%)
Tryp_SPc 68..309 CDD:214473 62/272 (23%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.