DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and scaf

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:93/255 - (36%) Gaps:61/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAP 142
            |.|..|.:.|    .|.....|||.:|.::|||::|.|:.........|:.||.:..|.:|   |
  Fly   433 EIPWQAMILR----ESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNE---P 490

  Fly   143 RDYMVAG---YIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGST 204
            ..:.:.|   ...||.|:.....||:.:::|...:.|..:..|.|:..:|.:.|:.....|||..
  Fly   491 LPFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQ 555

  Fly   205 GLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLM 269
            .|::.....|:.|                 .:..|:              |:..|:.||.. :..
  Fly   556 ALSIHEEGALMHV-----------------TDTLPQ--------------ARSECSADSSS-VCS 588

  Fly   270 YHREYPCMYVVVGITSAGLSCGSPG---IPGIYTR------------VYPYLGWIARTLA 314
            ..:...|.:.|    .:.|:|||..   :.||:..            ..|.:.||....|
  Fly   589 ATKFDSCQFDV----GSALACGSGSSVRLKGIFAGENSCGEGQTVRFAKPDIKWINTAFA 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 54/251 (22%)
Tryp_SPc 68..309 CDD:214473 52/248 (21%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 49/225 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.