DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG17572

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:320 Identity:93/320 - (29%)
Similarity:144/320 - (45%) Gaps:63/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPL---------IVGGHPAQP-REF 79
            :|..||....||::         ..|:|.|...:  |...:||         :|.||..:. ..:
  Fly    87 EVARSCYYGDKSLY---------CGGSSEELPYV--CCPSSPLEKNQVCGKSLVQGHFYKGLGSY 140

  Fly    80 PHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHC--LESERGEVNVVRLGELDFDSLDED--- 139
            |.:||:|.:...:....:.|.|.:|:.|.:||||||  .:::...::.||:||.|..| |.|   
  Fly   141 PFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRVGEYDTSS-DPDCAN 204

  Fly   140 ---AAPR--DYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSS-----D 194
               .|||  ::.::..|.||.|:..|::|||.|:.|...:.:.:...|.||  |..|::     .
  Fly   205 TGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICL--QKTRANLVVGKR 267

  Fly   195 SFIAVGWG--STGLALKPSAQLLKVK-------LQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCV 250
            :.|| |||  ||....:|....|.|.       |:.||:       |..:|. |...:| ..:|.
  Fly   268 ATIA-GWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGS-------TGALES-PNSIEG-QWMCA 322

  Fly   251 GSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL-SCGSPGIPGIYTRVYPYLGWI 309
            |.| .:|.|.|..|.||.:....   ::..:||.|.|. :||...||.:||.|..:..||
  Fly   323 GGE-GKDVCQGFGGAPLFIQENG---IFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 82/268 (31%)
Tryp_SPc 68..309 CDD:214473 80/266 (30%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 79/258 (31%)
Tryp_SPc 138..378 CDD:214473 77/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.