DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG9377

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:366 Identity:82/366 - (22%)
Similarity:128/366 - (34%) Gaps:92/366 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FSQLIVSLACVFGQ-QPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIESR----IIDNC----- 61
            |.:::|  .|:.|. .|.:.....|...|..|..|:...|.::.|.....|    :.:||     
  Fly     3 FYRIVV--ICLLGSLVPSIAASKVCGPEKHCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHYMEK 65

  Fly    62 ------RSYTPLI--------VGG---------------HPAQPREFPHMARLGRRPDPSSRADW 97
                  :..||.|        .||               ..|:..|||.:..:      .....:
  Fly    66 CCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAV------YGSDTY 124

  Fly    98 FCGGVLISERFVLTAAHCLESERGEVNVVRL--GELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQ 160
            .|.|.||:...|:|.|||:::  .|:..|||  ||.|.....|....:...|...:.||.|....
  Fly   125 LCSGALITPLAVITTAHCVQN--SEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMP 187

  Fly   161 FYHDIGLVKLTEAVVFDLYKH--PACLPFQDER----SSDSFIAVGW-----GSTGL-------- 206
            ..|:|.::.:.:...|.|..:  |.|||  ..|    .|..::: ||     |...:        
  Fly   188 LAHNIAILLVDKEKPFQLAPNVQPICLP--PPRIMYNYSQCYVS-GWQRSDFGRAAILPKRWTLY 249

  Fly   207 ALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGD---SGGPLL 268
            .|.|.....|::|...|.               |....::.||.|.:.....| ||   :..||:
  Fly   250 VLPPDQCRTKLRLSLLGR---------------RHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLM 298

  Fly   269 MYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            .....:...:.:.|:.:....|..|.:.||||.|..|..||
  Fly   299 CPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 66/289 (23%)
Tryp_SPc 68..309 CDD:214473 64/287 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 63/262 (24%)
Tryp_SPc 105..339 CDD:214473 61/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.