DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and TMPRSS7

DIOPT Version :10

Sequence 1:NP_651663.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:226 Identity:66/226 - (29%)
Similarity:96/226 - (42%) Gaps:34/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 FCGGVLISERFVLTAAHCLESER--------GEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHP 154
            :||..:||..::|:||||....|        ..:.:...|...|.|          .|...:.|.
Human   630 YCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFVS----------PVRRIVVHE 684

  Fly   155 GYEDPQFYHDIGLVKLTEAVVFDLYK--HPACLP--FQDERSSDSFIAVGWGSTGLA-LKPSAQL 214
            .|....|.:||.|::|:.|....|.:  .|.|:|  .|..||.:.....|||....| .|.|..|
Human   685 YYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPTGQRVRSGEKCWVTGWGRRHEADNKGSLVL 749

  Fly   215 LKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVG-SEMAQDTCNGDSGGPLLMYHREYPCMY 278
            .:.:::.....:|       |..:  |...:..||.| ....:|.|.|||||| |...|:....:
Human   750 QQAEVELIDQTLC-------VSTY--GIITSRMLCAGIMSGKRDACKGDSGGP-LSCRRKSDGKW 804

  Fly   279 VVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            ::.||.|.|...|.|..||:||||..::.||
Human   805 ILTGIVSWGHGSGRPNFPGVYTRVSNFVPWI 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_651663.1 Tryp_SPc 68..312 CDD:238113 66/226 (29%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
SEA 108..207 CDD:460188
CUB 247..359 CDD:238001
LDLa 484..518 CDD:238060
LDLa 559..594 CDD:238060
Tryp_SPc 605..835 CDD:214473 64/224 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.