DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:294 Identity:76/294 - (25%)
Similarity:110/294 - (37%) Gaps:79/294 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCG 100
            |.|:|::....|.....||.|           |..|:.|...:.|:...||      ....|:||
  Fly    16 SAFDEKVFVKDLPKATKIEGR-----------ITNGYAAPEGKAPYTVGLG------FSGGWWCG 63

  Fly   101 GVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYH-- 163
            |.:|:..:||||.||:                     .|||    .|..|.......:.||.|  
  Fly    64 GSIIAHDWVLTAEHCI---------------------GDAA----SVIVYFGATWRTNAQFTHTV 103

  Fly   164 -----------DIGLVKLTEAVVFDLYKHPACLPFQDERSSDS----FIAVGWGST--GLALKPS 211
                       ||.|:::.. |.|....:...||..::|.::.    .:|.|||.|  |..|...
  Fly   104 GNGNFIKHSNADIALIRIPH-VDFWHMVNKVELPSYNDRYNNYNEWWAVACGWGGTYDGSPLPDW 167

  Fly   212 AQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPC 276
            .|.  |.||...|..|         .:..|..|:|.:|..:...:..|.|||||||:.:...   
  Fly   168 LQC--VDLQIVHNEEC---------GWTYGSVGDNVICTRTVDGKSICGGDSGGPLVTHDGS--- 218

  Fly   277 MYVVVGITSAGLSCG-SPGIPGIYTRVYPYLGWI 309
              .:||:::...|.| ..|.|..:.||..:|.||
  Fly   219 --KLVGVSNFVSSNGCQSGAPAGFQRVTYHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 69/262 (26%)
Tryp_SPc 68..309 CDD:214473 67/260 (26%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 68/272 (25%)
Tryp_SPc 37..253 CDD:238113 69/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.