DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Hayan

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:126/269 - (46%) Gaps:15/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAA 113
            |..:...:|....:..|..|:.|.......:||||.:......|  |.:.|||.||:.|||||||
  Fly   366 PSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSFGS--AAFRCGGSLIASRFVLTAA 428

  Fly   114 HCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTE-AVVFD 177
            ||:.|:....:.||||.|:.:  :.:...:|..|.....||.|.....|:||.:::|.| |...|
  Fly   429 HCVNSDDSTPSFVRLGALNIE--NPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESD 491

  Fly   178 LYKHPACL--PFQDERSSDSFIAVGWGSTGLALKP-SAQLLKVKLQRYGNWVCKKLLTRQV---E 236
            :.: ||||  ...|..::..:...|||...:..:. |..||:..|.......|......|.   .
  Fly   492 VIR-PACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANR 555

  Fly   237 EFPRGFDGNNQLCVGSE-MAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYT 300
            ...||... :|||...: ..:|.|.|||||||::...:....|.:||:.|:|..|.:. .||:||
  Fly   556 TLRRGVIA-SQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVISSGFGCATK-TPGLYT 618

  Fly   301 RVYPYLGWI 309
            ||..:|.:|
  Fly   619 RVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 82/250 (33%)
Tryp_SPc 68..309 CDD:214473 81/248 (33%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 81/249 (33%)
Tryp_SPc 385..630 CDD:238113 82/250 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.