DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG31220

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:290 Identity:87/290 - (30%)
Similarity:122/290 - (42%) Gaps:78/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TPLIVGGHPAQPREFPHMARLGRR------PD----PSSRADWFCGGVLISERFVLTAAHCLESE 119
            |..::||......|:|.:|.|..|      ||    ||      |||.||:.|:|||||||:...
  Fly   101 TNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPS------CGGSLINTRYVLTAAHCVTDT 159

  Fly   120 RGEVNVVRLGE----------------------LDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFY 162
            ..::..|||||                      ||.| ::...:..||..|.|         .|.
  Fly   160 VLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDID-VESITSHNDYDPANY---------TFR 214

  Fly   163 HDIGLVKLTEAVVFDLYKHPAC-LPFQDERSSDSFIAVGWGSTGL------ALKPSAQLLKVK-- 218
            :||.||:|.|.|.:.:..:|.| |.:............|||.||:      .||.:|  :||:  
  Fly   215 NDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMFDTGSKVLKHAA--VKVRKP 277

  Fly   219 ---LQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLL-MYHREYPCMYV 279
               .::|.:               |.|....|:|.|....:.||:||||.||: ...|.|..:..
  Fly   278 EECSEKYAH---------------RHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITF 327

  Fly   280 VVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            :.||||.|..||:.|.|.::||...:..||
  Fly   328 LAGITSYGGPCGTIGWPSVFTRTAKFYKWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 86/287 (30%)
Tryp_SPc 68..309 CDD:214473 84/285 (29%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 84/286 (29%)
Tryp_SPc 104..360 CDD:238113 86/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.