DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG11664

DIOPT Version :10

Sequence 1:NP_651663.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:33 Identity:11/33 - (33%)
Similarity:16/33 - (48%) Gaps:8/33 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   974 LLGLGLLGV--PSLAEHFN------ELQNKLQE 998
            :||:.|.|.  |.:..||:      ||..||.:
  Fly    26 ILGMVLNGTPFPDILRHFHVSDFSKELAEKLNK 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_651663.1 Tryp_SPc 68..312 CDD:238113
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:473915 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.