DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and GZMA

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:288 Identity:83/288 - (28%)
Similarity:120/288 - (41%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RIEFGFLLPGASIESRII----DNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGG 101
            |..:.||....|:...::    |.|..    |:||:...|...|:|..|      |......|.|
Human     2 RNSYRFLASSLSVVVSLLLIPEDVCEK----IIGGNEVTPHSRPYMVLL------SLDRKTICAG 56

  Fly   102 VLISERFVLTAAHCLESERGEV-----NVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQF 161
            .||::.:|||||||..::|.:|     ::.|          |:...:..:|.....:|.|:....
Human    57 ALIAKDWVLTAAHCNLNKRSQVILGAHSITR----------EEPTKQIMLVKKEFPYPCYDPATR 111

  Fly   162 YHDIGLVKLTEAVVFDLYKHPACLPFQ--DERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGN 224
            ..|:.|::|.|....:.|.....||.:  |.:........|||.|..:...|..|.:|.:.....
Human   112 EGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDR 176

  Fly   225 WVCKKLLTRQVEEFPRGFDGNNQLCVGS-EMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGL 288
            .||.   .|....| ....|.|.:|.|| ...:|:||||||.|||       |..|..|:||.||
Human   177 KVCN---DRNHYNF-NPVIGMNMVCAGSLRGGRDSCNGDSGSPLL-------CEGVFRGVTSFGL 230

  Fly   289 --SCGSPGIPGIYTRV-YPYLGWIARTL 313
              .||.|..||:|..: ..:|.||..|:
Human   231 ENKCGDPRGPGVYILLSKKHLNWIIMTI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 76/254 (30%)
Tryp_SPc 68..309 CDD:214473 74/251 (29%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.