DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Gzmk

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_058815.1 Gene:Gzmk / 29165 RGDID:68401 Length:258 Species:Rattus norvegicus


Alignment Length:286 Identity:86/286 - (30%)
Similarity:120/286 - (41%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVL 110
            ||:.|..:.|      .|:...|:||...||...|.||.:      ..|....||||||..::||
  Rat    10 FLVAGIYMSS------ESFHTEIIGGREVQPHSRPFMASI------QYRGKHICGGVLIHPQWVL 62

  Fly   111 TAAHCLESERGEVNVVRLGELDFDSLDE-DAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAV 174
            |||||.  .||....|.||.   .||.: :...:.:.:..:|...|::...  :||.|:||..|.
  Rat    63 TAAHCY--SRGHSPTVVLGA---HSLSKNEPMKQTFEIKEFIPFSGFKSGT--NDIMLIKLRTAA 120

  Fly   175 VFDLYKHPACLPFQDE---RSSDSFIAVGWGSTG---LALKPSAQLLKVKL--------QRYGNW 225
              :|.||...|..:.:   |........|||||.   |....:.|.:.|.:        |.|.|.
  Rat   121 --ELNKHVQLLHLRSKNYIRDGTKCQVTGWGSTKPDVLTTSDTLQEVTVTIISRKRCNSQSYYNH 183

  Fly   226 VCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQ-DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLS 289
              |.::|:            :.:|.|....: |:|.|||||||:       |..|...:.|.|..
  Rat   184 --KPVITK------------DMICAGDRRGEKDSCKGDSGGPLI-------CKGVFHALVSGGYK 227

  Fly   290 CGSPGIPGIYTRV-YPYLGWIARTLA 314
            ||....||:||.: ..|..||...||
  Rat   228 CGISNKPGVYTLLTKKYQTWIKSKLA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/260 (30%)
Tryp_SPc 68..309 CDD:214473 77/257 (30%)
GzmkNP_058815.1 Tryp_SPc 25..248 CDD:214473 77/258 (30%)
Tryp_SPc 26..251 CDD:238113 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.