DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG18420

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:279 Identity:78/279 - (27%)
Similarity:118/279 - (42%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SRIIDN-CRSYTPL-----IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAA 113
            ::.:|: |.:.:||     ||.|..|.....|.||.|     .:|...:.|||.|||.|.|||||
  Fly    24 TQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFL-----HTSSNQFICGGTLISRRLVLTAA 83

  Fly   114 HCLESERGEVNVVRLGELD--FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVF 176
            ||...  ....||||||.:  .....|     ::.|.....|..|:.....:||.|::|...||:
  Fly    84 HCFIP--NTTIVVRLGEYNRKLKGYRE-----EHQVNRTFQHRFYDPNTHANDIALLRLVSNVVY 141

  Fly   177 DLYKHPACLPFQD--ERSSDS---FIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVE 236
            .....|.|:.:..  :...||   ....|||.|. ::..|::|..:.:.|..:.:|         
  Fly   142 KANIRPICIMWDASWKHHIDSIKVLTGTGWGRTE-SMHDSSELRTLDISRQPSKMC--------- 196

  Fly   237 EFPRGFDG--NNQLCVGSEMAQDTCNGDSGGP---LLMYHREYPCMYVVVGITSAGLSCGSPGIP 296
                .|..  :||.|.|: ...:.|.||:|||   ::.|...:  .:|.|||......|..   |
  Fly   197 ----AFGSVLSNQFCAGN-WNSNLCIGDTGGPVGAMVRYRNAF--RFVQVGIAITNKRCQR---P 251

  Fly   297 GIYTRVYPYLGWIARTLAT 315
            .::|.|..::.:|.|...|
  Fly   252 SVFTDVMSHIEFIRRIFLT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 72/255 (28%)
Tryp_SPc 68..309 CDD:214473 71/252 (28%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 71/253 (28%)
Tryp_SPc 43..267 CDD:238113 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.