DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Tpsg1

DIOPT Version :10

Sequence 1:NP_651663.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:94 Identity:24/94 - (25%)
Similarity:39/94 - (41%) Gaps:17/94 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SSTTSPPETSSSSNIVYPNGDPMLLSTSPTPGPGVASSSSSSASSSSSTSSSTTGTANLYEAVDQ 75
            :|..|.|:||:...:...:.:|..|:.. |....|::|:.|..|.|.|...|..     |:.:.:
Mouse   515 TSQQSIPKTSTIFGLQQHHTNPSSLNRQ-THSTSVSTSTLSLPSKSGSEKKSPK-----YKDIFK 573

  Fly    76 QE--------LLLSNSHHSAAF---HGHQ 93
            :|        .|..|..||..|   :.||
Mouse   574 KEEQTSKERPTLGPNDQHSCNFMDLNNHQ 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_651663.1 Tryp_SPc 68..312 CDD:238113 9/37 (24%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.