DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Gzma

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:294 Identity:82/294 - (27%)
Similarity:123/294 - (41%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSR 94
            |:.:..|:  ..:.|..|:|....|.            |:||....|...|:|..|..:||.   
  Rat     5 CAPWVSSL--TTVIFLLLIPEGGCER------------IIGGDTVVPHSRPYMVLLKLKPDS--- 52

  Fly    95 ADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDP 159
               .|.|.||::.:|||||||:..::.||      .|...|:.::...:...|.....:|.::..
  Rat    53 ---ICAGALIAKNWVLTAAHCIPGKKSEV------ILGAHSIKKEPEQQILSVKKAYPYPCFDKH 108

  Fly   160 QFYHDIGLVKLTEAVVFDLYKHPACLPF----QDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQ 220
            ....|:.|::|.:...  |.|:.|.|..    .|.:........|||.......||..|.:|.:.
  Rat   109 THEGDLQLLRLKKKAT--LNKNVAILHLPKKGDDVKPGTRCHVAGWGRFHNKSPPSDTLREVNIT 171

  Fly   221 RYGNWVCKKLLTRQVEEFPRGFD---GNNQLCVGS-EMAQDTCNGDSGGPLLMYHREYPCMYVVV 281
            .....:|.       :|....|:   |.|.:|.|: ...:|:|.||||||||       |..:..
  Rat   172 VIDRKICN-------DEKHYNFNPVIGLNMICAGNLRGGKDSCYGDSGGPLL-------CEGIFR 222

  Fly   282 GITSAGLS--CGSPGIPGIYTRVY-PYLGWIART 312
            |||:.||.  ||.|..|||||.:. .:|.||.:|
  Rat   223 GITAFGLEGRCGDPKGPGIYTLLSDKHLDWIRKT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 75/254 (30%)
Tryp_SPc 68..309 CDD:214473 73/251 (29%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 73/264 (28%)
Tryp_SPc 29..256 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.