DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30323

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:266 Identity:53/266 - (19%)
Similarity:92/266 - (34%) Gaps:90/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 FCGGVLISERFVLTAAHCLE----------SERGEVNVV-------------RLGELDFDSLDED 139
            ||.|.|:|..:|:|:..|:.          |.|..:.||             .:..:....|||.
  Fly    53 FCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDES 117

  Fly   140 AAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGST 204
            |      ::|..            ::.|:||...|...  :....||.::..|:....::|||..
  Fly   118 A------ISGCT------------ELALLKLDRGVTGQ--RFAMMLPEKELNSTWLCNSLGWGRI 162

  Fly   205 GL-------ALKP------------------SAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDG 244
            ..       |:.|                  |::|::::.|:...:.||.             |.
  Fly   163 YYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKP-------------DC 214

  Fly   245 NNQLCVGSEMAQ-DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGW 308
            :..||:.|...: :.|..|.|.||.       |.:.:.|:.....:|...|.. .||.:|....:
  Fly   215 SRCLCMTSYTGRGNMCQQDLGSPLF-------CDHFLYGVARRVHTCDDEGFM-FYTNIYQNRKF 271

  Fly   309 IARTLA 314
            |..||:
  Fly   272 IEDTLS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 51/262 (19%)
Tryp_SPc 68..309 CDD:214473 50/259 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 51/262 (19%)
Tryp_SPc 45..272 CDD:214473 50/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.