DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30286

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:266 Identity:90/266 - (33%)
Similarity:128/266 - (48%) Gaps:52/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 HPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSL 136
            |.|...|.|.||.|.:      ..:..|||.|::.||:||||||:..:  |...|||||  |:||
  Fly    39 HQAHISESPWMAYLHK------SGELVCGGTLVNHRFILTAAHCIRED--ENLTVRLGE--FNSL 93

  Fly   137 ------DEDAAP--RDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACL-------P 186
                  ..|..|  .|:.:.....|.||......|||||::|.::|.:.::..|.||       |
  Fly    94 TSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQP 158

  Fly   187 FQDERSSDSFIAVGWGSTGLALKPSA---QLLK-VKLQRYGNW-VCKKLLTRQVEEFPRGFDGNN 246
             :.|| ....:|.|||.:     ||.   .:|| :::.|. || ||.|  |..|:.      ..:
  Fly   159 -KIER-LHRLVATGWGRS-----PSEAANHILKSIRVTRV-NWGVCSK--TYWVDR------RRD 207

  Fly   247 QLCVGSEMAQDTCNGDSGGPLLMYHR-EYPCMYVVVGITSAG-LSCGSPGIPGIYTRVYPYLGWI 309
            |:||..|... :|:||||||:....| :...::|.|||.|.| ..|.|   |.::|.|..::.||
  Fly   208 QICVSHESGV-SCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLS---PSVFTNVMEHIDWI 268

  Fly   310 ARTLAT 315
            ...|:|
  Fly   269 MAALST 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 88/261 (34%)
Tryp_SPc 68..309 CDD:214473 86/258 (33%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 87/259 (34%)
Tryp_SPc 39..268 CDD:214473 86/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.