DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30187

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:287 Identity:89/287 - (31%)
Similarity:132/287 - (45%) Gaps:51/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FGFLLP-GASIESRIIDN-CRSYTPL-IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLIS 105
            |.||.. ||||   .:|. |.....| |.|||.|..:....||.:      .:|..:.|||.||.
  Fly    12 FWFLKDVGASI---FLDQICGINIALKITGGHNAAFQNSVWMAAV------HNRTHFICGGTLIH 67

  Fly   106 ERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFY-HDIGLVK 169
            :|||||||||:..:  :|..|.||..:    ..|.|.|..::.. :.|..::....| :||||:|
  Fly    68 KRFVLTAAHCIVDQ--DVQSVSLGAYN----KSDPADRKDVITA-VVHSSFDVRASYENDIGLLK 125

  Fly   170 LTEAVVFDLYKHPACLPFQDE-----RSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKK 229
            |:..|:|:....|.|:.....     |:..:|.|.|||:  |....::.:|:..:.   |.:.::
  Fly   126 LSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGT--LRGNKTSDILQTIIL---NHLDRE 185

  Fly   230 LLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLL-------MYHREYPCMYVVVGITSAG 287
            ....::..:|    ...|:|.|.. :.|||.|||||||.       :.:||     |..||.|.|
  Fly   186 ECYMELSVYP----SEKQICAGVP-SGDTCGGDSGGPLTNDVFIQGIGNRE-----VQFGIISVG 240

  Fly   288 -LSCGSPGIPGIYTRVYPYLGWIARTL 313
             .||..   .|:||.:..:..||..|:
  Fly   241 KTSCDG---QGVYTDLMSFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 78/257 (30%)
Tryp_SPc 68..309 CDD:214473 76/254 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 76/255 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.