DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30098

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:261 Identity:83/261 - (31%)
Similarity:110/261 - (42%) Gaps:53/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVN---VVRLG 129
            ::||..|  |..|.||.|.|    .:|  :.|||.||:.|||||||||.     ::|   .||||
  Fly    37 VIGGQNA--RRTPWMAYLIR----DNR--FACGGSLIAYRFVLTAAHCT-----KINDNLFVRLG 88

  Fly   130 ELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQD----- 189
            |.| .|...|...|.|.|.....|..|.|.: .|||.::||...||:|.|..|.|:....     
  Fly    89 EYD-SSRTTDGQTRSYRVVSIYRHKNYIDFR-NHDIAVLKLDRQVVYDAYIRPICILLNSGLQSL 151

  Fly   190 ERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEM 254
            ..|..:|...|||......|....|.::.|:|..|..|             |....:..|...  
  Fly   152 ANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-------------GVPSLSICCWNP-- 201

  Fly   255 AQDTCNGDSGGPL-LMYHREYPCMYVVVGITSA------GLSCGSPGIPGIYTRVYPYLGWIART 312
            .|..|.||||||| .:....:..:||..|:|::      |.|.        |..:..|:.|:.:|
  Fly   202 VQYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS--------YLDLMSYMPWLYQT 258

  Fly   313 L 313
            |
  Fly   259 L 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/258 (31%)
Tryp_SPc 68..309 CDD:214473 80/255 (31%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 80/254 (31%)
Tryp_SPc 37..258 CDD:238113 81/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.