DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30091

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:287 Identity:85/287 - (29%)
Similarity:131/287 - (45%) Gaps:39/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FGFLLPGASIESRIID-NC---RSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLI 104
            |.::|......:|::| :|   ....|.||||..|...:.|.||.:      .:..::.|||.:|
  Fly     9 FAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALI------KTNDEFICGGSVI 67

  Fly   105 SERFVLTAAHCLESERGEVNV------VRLGELDFDSLDEDAAPRD-YMVAGYIAHPGYEDPQFY 162
            :.:||||||||:.::. |..|      |.||.....:..|...|.: |.|.....|..:....:.
  Fly    68 TNKFVLTAAHCMCTDE-ECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYR 131

  Fly   163 HDIGLVKLTEAVVFDLYKHPACLPFQDERSSDS-----FIAVGWGSTGLALKPSAQLLKVKLQRY 222
            :||.|::|.:::|:.....|.|:...|:....:     |.|:|||.||.. |.|..|..||:.|.
  Fly   132 NDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNG-KMSNNLQMVKIYRI 195

  Fly   223 GNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCM--YVVVGITS 285
            ...:|:       ..|...|| ....|.|:.:.:|||..||||||.: |..:..:  ...:||.|
  Fly   196 DRKMCE-------AAFWYTFD-YPMFCAGTAVGRDTCKRDSGGPLYI-HMLFDGIKRATQLGIVS 251

  Fly   286 AGL-SCGSPGIPGIYTRVYPYLGWIAR 311
            .|. .|  .|. |:||.|..::.:|.|
  Fly   252 TGTEDC--RGF-GMYTDVMGHIDFIER 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/259 (31%)
Tryp_SPc 68..309 CDD:214473 77/255 (30%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 77/256 (30%)
Tryp_SPc 37..276 CDD:238113 79/259 (31%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.