DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG30090

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:256 Identity:93/256 - (36%)
Similarity:123/256 - (48%) Gaps:34/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132
            |:||..|.....|.||.:      .|.....|||.||::|||||||||:  ..|....|||||.|
  Fly    40 IIGGRDAIINSNPWMAYI------HSSVKLICGGTLITQRFVLTAAHCV--NEGSAVKVRLGEYD 96

  Fly   133 FDSLDED-----AAPR--DYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDE 190
             |:..||     ..||  ::.|.....|..:.:.:..:||.|::|.:.|.|..:..|.|:.....
  Fly    97 -DTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICIILGTS 160

  Fly   191 R-----SSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCV 250
            :     |.:.|:|.|||.| ...:....|...:||||.:..|.:.|.|.|::        ||:|.
  Fly   161 KRELVDSIEWFVATGWGET-RTHRTRGVLQITQLQRYNSSQCMQALGRLVQQ--------NQICA 216

  Fly   251 GSEMAQDTCNGDSGGPLLMYHREYPCMY-VVVGITSAGLSCGSPGIPGIYTRVYPYLGWIA 310
            | .:..|||||||||||....|....|. |..|:.|.| |....|| |:||.||.|..|||
  Fly   217 G-RLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYG-SRECSGI-GVYTDVYSYADWIA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 93/256 (36%)
Tryp_SPc 68..309 CDD:214473 90/253 (36%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 90/253 (36%)
Tryp_SPc 40..276 CDD:238113 93/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.