DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Prss12

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032965.1 Gene:Prss12 / 19142 MGIID:1100881 Length:761 Species:Mus musculus


Alignment Length:260 Identity:87/260 - (33%)
Similarity:122/260 - (46%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRAD--WFCGGVLISERFVLTAAHCLE--SERGEVNVVRL 128
            |:||:.:....:|..|.|..|   |:..|  ..||..|:|..:|||||||.:  ........||:
Mouse   517 IIGGNNSLRGAWPWQASLRLR---SAHGDGRLLCGATLLSSCWVLTAAHCFKRYGNNSRSYAVRV 578

  Fly   129 GELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKL----TEAVVFDLYKHPACLPFQD 189
            |  |:.:|..:...::..|...:.|..|...:..:||.||:|    .:......:..|||||...
Mouse   579 G--DYHTLVPEEFEQEIGVQQIVIHRNYRPDRSDYDIALVRLQGPGEQCARLSTHVLPACLPLWR 641

  Fly   190 ER----SSDSFIAVGWGSTGLALKPSAQLLKVKL--QRYGNWVCKKLLTRQVEEFPRGFDGNNQL 248
            ||    :|:..| .|||.||.|...:.|...|.|  :|:    ||       |.:...|.| ..|
Mouse   642 ERPQKTASNCHI-TGWGDTGRAYSRTLQQAAVPLLPKRF----CK-------ERYKGLFTG-RML 693

  Fly   249 CVGS---EMAQDTCNGDSGGPLLMYHREYPC-MYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            |.|:   :...|:|.|||||||:.   |.|. .:||.|:||.|..||....||:||||..::.||
Mouse   694 CAGNLQEDNRVDSCQGDSGGPLMC---EKPDESWVVYGVTSWGYGCGVKDTPGVYTRVPAFVPWI 755

  Fly   310  309
            Mouse   756  755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 87/260 (33%)
Tryp_SPc 68..309 CDD:214473 85/258 (33%)
Prss12NP_032965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..87
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..265 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 396..485 CDD:278931
Zymogen activation region 505..516
Tryp_SPc 516..755 CDD:214473 85/258 (33%)
Tryp_SPc 517..758 CDD:238113 87/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.