DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Plau

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:314 Identity:90/314 - (28%)
Similarity:127/314 - (40%) Gaps:70/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNC--RSYTP--LIVGGHPAQPREFPHMARLG 86
            :|..||..||             |.:|::.:.. .|  ::..|  .||||...:....|..|.:.
Mouse   148 MVHDCSLSKK-------------PSSSVDQQGF-QCGQKALRPRFKIVGGEFTEVENQPWFAAIY 198

  Fly    87 RRPDPSSRADWFCGGVLISERFVLTAAHC-LESERGEVNVVRLGELDFDSLDEDAAPRD--YMVA 148
            ::....|...:.|||.|||..:|.:|||| ::..:.|..||.||:    |.:....|.:  :.|.
Mouse   199 QKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVYLGQ----SKESSYNPGEMKFEVE 259

  Fly   149 GYIAHPGY-EDPQFYH-DIGLVKLTEAVVFDLYKHPA------CLP--FQDERSSDSFIAVGWG- 202
            ..|.|..| ||...|| ||.|:|:..:.  .....|:      |||  |.|..........|:| 
Mouse   260 QLILHEYYREDSLAYHNDIALLKIRTST--GQCAQPSRSIQTICLPPRFTDAPFGSDCEITGFGK 322

  Fly   203 -STGLALKP-SAQLLKVKL---------QRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGS-EMA 255
             |....|.| :.::..|||         ..||:.:..|:                 ||... |..
Mouse   323 ESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYKM-----------------LCAADPEWK 370

  Fly   256 QDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
            .|:|.|||||||:......|   .:.||.|.|..|.....||:||||..:|.||
Mouse   371 TDSCKGDSGGPLICNIEGRP---TLSGIVSWGRGCAEKNKPGVYTRVSHFLDWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/268 (30%)
Tryp_SPc 68..309 CDD:214473 79/266 (30%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799 1/3 (33%)
Connecting peptide 153..179 7/39 (18%)
Tryp_SPc 180..424 CDD:238113 81/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.