DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Plat

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus


Alignment Length:338 Identity:89/338 - (26%)
Similarity:127/338 - (37%) Gaps:125/338 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DMDVVGSCS--RYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARL 85
            ||....:|.  :||:..|  ||:.|.                 ||.  :..||.|...|     :
Mouse   290 DMSPCSTCGLRQYKRPQF--RIKGGL-----------------YTD--ITSHPWQAAIF-----V 328

  Fly    86 GRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRL----------GELDFDSLDEDA 140
            ..:..|..|  :.|||||||..:||:||||. .||...|.:::          ||.:        
Mouse   329 KNKRSPGER--FLCGGVLISSCWVLSAAHCF-LERFPPNHLKVVLGRTYRVVPGEEE-------- 382

  Fly   141 APRDYMVAGYIAHPGYEDPQFYHDIGLVKL-----------------------------TEAVVF 176
              :.:.:..||.|..::|..:.:||.|::|                             ||..:.
Mouse   383 --QTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTECELS 445

  Fly   177 DLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRG 241
            ...||.|..||..:|..::.:         .|.||::.....|       ..|.:|         
Mouse   446 GYGKHEASSPFFSDRLKEAHV---------RLYPSSRCTSQHL-------FNKTVT--------- 485

  Fly   242 FDGNNQLCV------GSEMAQDTCNGDSGGPLLMYHREYPCM----YVVVGITSAGLSCGSPGIP 296
               ||.||.      |::...|.|.|||||||:       ||    ..:.||.|.||.||...:|
Mouse   486 ---NNMLCAGDTRSGGNQDLHDACQGDSGGPLV-------CMINKQMTLTGIISWGLGCGQKDVP 540

  Fly   297 GIYTRVYPYLGWI 309
            |:||:|..||.||
Mouse   541 GVYTKVTNYLDWI 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 78/291 (27%)
Tryp_SPc 68..309 CDD:214473 76/289 (26%)
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 2/4 (50%)
Tryp_SPc 311..556 CDD:238113 81/315 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.