DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and try-5

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:273 Identity:66/273 - (24%)
Similarity:94/273 - (34%) Gaps:89/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GRRPDPSSRADW---------------FCGGVLISERFVLTAAHCLE------SERGEVNVV--R 127
            |...:|:..|.|               .|||.||:.:.|||||||.:      .|.||.|.:  |
 Worm    45 GNTGNPTHLAPWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGR 109

  Fly   128 LGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLV---------KLTEAVVFDLYK--- 180
            ..|.:....|.:...|..:..|.:.      .:.....|.|         |::...:.|.||   
 Worm   110 YCESNQRFTDSEILTRTVVTVGAMC------TRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHC 168

  Fly   181 ---------------------HPACLPFQDE---RSSDSFIAVGWGS---TGL--ALKPSAQLLK 216
                                 :.|||||..|   :|..:..:.||||   .|.  |..|..|:|.
 Worm   169 EQGNDIVILELESTIDDVEGANYACLPFLPEVNIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLT 233

  Fly   217 VKLQRYG----NWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCM 277
            :..:...    ||         ....|  ||   ..|...|..::.|:|||||. |.:|:.....
 Worm   234 LATETLATCEENW---------GTSIP--FD---SFCTAEEEDKNVCSGDSGGG-LTFHQSDSAR 283

  Fly   278 YVVVGITSAGLSC 290
            ..::.|.|.|..|
 Worm   284 EFIIAIVSYGSDC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 66/273 (24%)
Tryp_SPc 68..309 CDD:214473 66/273 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 64/268 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.