DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and try-3

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:306 Identity:77/306 - (25%)
Similarity:121/306 - (39%) Gaps:98/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SRIIDNC-RSYTPL----IVGGHPAQPREFPHMARLGRRPDPSSRADW--------------FCG 100
            |..|:.| .||.|:    |:||:..                 ...|:|              .||
 Worm    20 SNAINLCEESYKPIFSFRIIGGNSI-----------------DDGANWMAKLVSYGDNGQGILCG 67

  Fly   101 GVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDE--DAAPRDYMVAGYIAHPGYEDPQFYH 163
            ..:|.:.:::|||||         .::|....|..:.|  :...|.:.|.....|.||.:....:
 Worm    68 ATVIDDFWLVTAAHC---------ALQLQTRSFVYVREPKNNRERSFSVKEAYIHSGYNNQTADN 123

  Fly   164 DIGLVKLTEAVVFDLYK---HPACLPFQDERSSDSF---IAVGWG------STGLALKPSAQLLK 216
            ||.|::::.    ||.|   .|.||...|.:....:   :.:|:|      |:|.....::|.|:
 Worm   124 DIALLRISS----DLSKLGIKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQ 184

  Fly   217 ------------VKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLM 269
                        ||     .|....||:.::..:        |:|.|:.: ..|..||||||||:
 Worm   185 STSVPIISDDDCVK-----TWRFLSLLSVKITGY--------QICAGAYL-HGTAPGDSGGPLLI 235

  Fly   270 YHREYPCMYVVVGITSAGLSCGSPGI------PGIYTRVYPYLGWI 309
            :.....  ||.:||||.|.. |..|:      ||:|||:..|:.||
 Worm   236 HKSNGE--YVQIGITSYGAD-GLDGVIDQGKFPGVYTRISKYVPWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 71/288 (25%)
Tryp_SPc 68..309 CDD:214473 69/286 (24%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 71/288 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.