DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and svh-1

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:314 Identity:86/314 - (27%)
Similarity:126/314 - (40%) Gaps:66/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LACVFGQQPDMDVVGSCS-RYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPR 77
            ::|:  .|..|.....|. ||                   :|....|..:|....:|||....|.
 Worm   679 ISCI--SQNGMSSASQCGLRY-------------------VEVNARDAAKSRIARVVGGFETVPG 722

  Fly    78 EFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCL-ESERGEVNVVRLGELDFDSLDEDAA 141
            .||..|.|..:...:..    ||..::.:..::|||||. |.||.....|.:|  |:|:...|..
 Worm   723 AFPWTAALRNKATKAHH----CGASILDKTHLITAAHCFEEDERVSSYEVVVG--DWDNNQTDGN 781

  Fly   142 PRDYMVAGYIAHPGYEDPQFYHDIGLVKLT-EAVVFDLYKHPACLPFQD--ERSSDSFIAVGWGS 203
            .:.:.:.....:|.|:| .|.|||.::::. ..:.|:.|..|.|||.:|  .......:..||||
 Worm   782 EQIFYLQRIHFYPLYKD-IFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGS 845

  Fly   204 TGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQ------------ 256
            .||              ||    .::|....:....| ||..|...:.|.|::            
 Worm   846 MGL--------------RY----AERLQAALIPIINR-FDCVNSSQIYSSMSRSAFCAGYLEGGI 891

  Fly   257 DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWIA 310
            |:|.||||||...  |.....:|:.|:.|.|..|.....|||||.|.|||.||:
 Worm   892 DSCQGDSGGPFAC--RREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWIS 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 77/259 (30%)
Tryp_SPc 68..309 CDD:214473 75/256 (29%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996 0/1 (0%)
Tryp_SPc 713..945 CDD:238113 77/259 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.