DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and try-10

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:240 Identity:57/240 - (23%)
Similarity:95/240 - (39%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SYTPLIVGGHPAQPREFPHMAR-LGRRPDPSSRADWFCGGVLISERFVLTAAHCLES--ERGEVN 124
            ||:..|:.|..|...:...:|. :.|.||.::..   ||||||:...|:|:|||:.|  :.....
 Worm    70 SYSTSIINGFSANSFDTLSLASVITRFPDGTTNV---CGGVLIAPSIVITSAHCVFSGDDFAVTA 131

  Fly   125 VVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVF-----DLYKHP-- 182
            .|.||::..:..|:....       :.:|......:|::|........||:|     |:...|  
 Worm   132 KVTLGDVHLNKHDDGEQE-------FRSHAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLS 189

  Fly   183 ---ACLP------FQDE--------RSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKL 230
               |.||      |::.        .:|..::| |||.|           :.|..:|.:.|.:.:
 Worm   190 LQIAKLPSTGSVNFKETAPLTQLQLETSVCYVA-GWGKT-----------ENKTAKYSDSVRQMM 242

  Fly   231 LTRQVEEFPRGFDGNNQLCV-----GSEMAQDTCNGDSGGPLLMY 270
            :...|...     |..:..:     ||..|   |.||||.|:..:
 Worm   243 VNLSVRRI-----GKRKYLIAKAVTGSSRA---CMGDSGSPVYCF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 55/235 (23%)
Tryp_SPc 68..309 CDD:214473 55/235 (23%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 55/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.