DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and try-1

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:330 Identity:89/330 - (26%)
Similarity:133/330 - (40%) Gaps:67/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIWRLFSQLIVSLACVFGQQPDMDVVGSCSRYKKSVFEERIEFGFLLPGASIE---SRIIDNCR 62
            ||:| :|..|:             .|:...|...|:...|::..|  |...::|   :|......
 Worm     1 MKVW-IFLLLV-------------GVINKVSTDNKNDVIEKVGCG--LHSTNVELAQTRSAQEPA 49

  Fly    63 SYTPL---IVGGHPAQPREFPH----MARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESER 120
            .|..|   ::||..:.|..:|.    ::|||...         |||.||...||||||||...:|
 Worm    50 DYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHR---------CGGSLIDPNFVLTAAHCFAKDR 105

  Fly   121 GEVNV-VRLGELDFDSLDEDAAPRDYMVAGYIAHPGYE--DPQFYHDIGLVKLTEAVVFDLYKHP 182
            ...:. ||:|.      ....:...:.|.....||.|.  .|..| |..::::...|.......|
 Worm   106 RPTSYSVRVGG------HRSGSGSPHRVTAVSIHPWYNIGFPSSY-DFAIMRIHPPVNTSTTARP 163

  Fly   183 ACLPFQDERSSDSFIAVGWGST--GLALK-PSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDG 244
            .|||......:...:..|||||  |.:|. |:.:.:.|.|          |.|......| .:.|
 Worm   164 ICLPSLPAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPL----------LSTLFCSSLP-NYIG 217

  Fly   245 N----NQLCVGSEMAQ-DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYP 304
            .    :.||.|....: |:|.|||||||:.....:   :.:.|:.|.|:.|..||:||:|..|:.
 Worm   218 RIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGH---WELTGVVSWGIGCARPGMPGVYGNVHS 279

  Fly   305 YLGWI 309
            ...||
 Worm   280 ASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 74/257 (29%)
Tryp_SPc 68..309 CDD:214473 72/255 (28%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.