DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Tpsb2

DIOPT Version :10

Sequence 1:NP_651663.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:63 Identity:14/63 - (22%)
Similarity:29/63 - (46%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 ERQCHIDKTQRKRCP--YCRFQKCLEVGMKLEAVRADRMRGGRNKFGPMYKRDRARKLQIMRQ 688
            |.:..:.|.:|:|.|  .|..:|..|:..| |:..|:.....:.:...:.|.:..:|.:..|:
Mouse   374 EEEEKLKKRRRRRRPRKNCMLEKVEEMEGK-ESEEAENHIEEKEQMNDIEKEEEVKKRRRRRR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_651663.1 Tryp_SPc 68..312 CDD:238113
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.