DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and Gzmk

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:265 Identity:79/265 - (29%)
Similarity:109/265 - (41%) Gaps:50/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLE-SERGEVNVVRLGEL 131
            |:||...||...|.||.:      ..|:...||||||..::|||||||.. ..||....|.||. 
Mouse    26 IIGGREVQPHSRPFMASI------QYRSKHICGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGA- 83

  Fly   132 DFDSLDE-DAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDE---RS 192
              .||.: :...:.:.:..:|.....:.....|||.|:||..|.  :|.|:...|....:   |.
Mouse    84 --HSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAA--ELNKNVQLLHLGSKNYLRD 144

  Fly   193 SDSFIAVGWGSTGLALKPSAQLL-----------KVKLQRYGNWVCKKLLTRQVEEFPRGFDGNN 246
            .......|||:|...|..::..|           :...|.|.|.  |.::|:            :
Mouse   145 GTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNH--KPVITK------------D 195

  Fly   247 QLCVGSEMAQ-DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRV-YPYLGWI 309
            .:|.|....| |:|.|||||||:       |..:...:.|.|..||....|||||.: ..|..||
Mouse   196 MICAGDARGQKDSCKGDSGGPLI-------CKGIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWI 253

  Fly   310 ARTLA 314
            ...||
Mouse   254 KSKLA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 77/261 (30%)
Tryp_SPc 68..309 CDD:214473 75/258 (29%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 75/258 (29%)
Tryp_SPc 26..256 CDD:238113 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.