DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG43742

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:287 Identity:89/287 - (31%)
Similarity:133/287 - (46%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FGFLLPGASIE----SRIID-NCR-SYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGV 102
            |..||....|.    ::::| ||: ..|..:..||.|...:|  ||.|      .:.:::||||.
  Fly     5 FSLLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQF--MAAL------YNNSEFFCGGS 61

  Fly   103 LISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDY------MVAGYIAHPGYEDPQF 161
            ||.:::|||||||:. :..|| .|.|||      :..:.|...      :.|..|.||.:....|
  Fly    62 LIHKQYVLTAAHCVR-DLDEV-TVHLGE------NNRSCPIPVCKHVLRLNAKVILHPNFHGNIF 118

  Fly   162 YHDIGLVKLTEAVVFDLYKHPACLPFQDERSS---DSFIAVGWGSTGLALKPSAQLLKVKLQRYG 223
            .:||.|::|...|:|:.:..|.|:...::.:|   ::|.|.|||.|                .:|
  Fly   119 LNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYGWGKT----------------EHG 167

  Fly   224 NWVCKKLLTRQVEEFPRG--FDGNNQLCVGSEMAQDTCNGDSGGPLL--MYHREYPCMYVVVGIT 284
            | :...|....:...|:.  :...|.:|.|| .:.|||..||||||:  ..||. ....::.|||
  Fly   168 N-ISDVLSFIDLVRLPKSMCYQNINTICAGS-TSGDTCESDSGGPLIGNFVHRG-KSRDILFGIT 229

  Fly   285 SAG-LSCGSPGIPGIYTRVYPYLGWIA 310
            |.| ..|.  |:.|:||.|..|..|||
  Fly   230 SYGDAECS--GLFGVYTDVNAYKSWIA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/257 (32%)
Tryp_SPc 68..309 CDD:214473 78/254 (31%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 78/255 (31%)
Tryp_SPc 35..256 CDD:238113 81/257 (32%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.