DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG43336

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:284 Identity:90/284 - (31%)
Similarity:125/284 - (44%) Gaps:43/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FLLP--GASIESRIIDNCRSYT---PLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLIS 105
            ||||  |::....:....|:::   |.:..|..|.....|.||.|     .|:...:.|||.||:
  Fly    11 FLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFL-----HSTDGRFICGGSLIT 70

  Fly   106 ERFVLTAAHCLESERGEVNVVRLGELDFDSL----DEDAAPR-DYMVAGYIAHPGYEDPQFYHDI 165
            .|.|||||||. .:|.|: |.||||.|.:..    |.....| :.||.....|..|......:||
  Fly    71 NRLVLTAAHCF-LDRTEL-VARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDI 133

  Fly   166 GLVKLTEAVVFDLYKHPACLPFQDER------SSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGN 224
            .:::|...|.:.....|.|:.. |.|      |.|.....|||.|. :...||:|..|.|.|...
  Fly   134 AILRLYRKVQYTDNIRPICIVI-DPRWRKYIDSLDPLTGTGWGKTE-SEGDSAKLRTVDLARKHP 196

  Fly   225 WVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGP---LLMYHREYPCMYVVVGITS- 285
            .||::..|..:..        ||.|.|:|.: :.||||||||   |:.|.:..  .:|.|||.| 
  Fly   197 EVCRRYATLSLTA--------NQFCAGNERS-NLCNGDSGGPVGALIPYGKSK--RFVQVGIASF 250

  Fly   286 AGLSCGSPGIPGIYTRVYPYLGWI 309
            ....|   .:..::|.|..|:.||
  Fly   251 TNTQC---VMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 83/257 (32%)
Tryp_SPc 68..309 CDD:214473 81/255 (32%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 81/256 (32%)
Tryp_SPc 40..271 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.