DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and CG43125

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:102/255 - (40%) Gaps:77/255 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPR- 143
            |.:.::  ||:.||...  |.|.||:||||||||.|::.:. |: :|||||:| .:|...:..: 
  Fly    37 PWLVKI--RPELSSNIT--CTGTLINERFVLTAASCIDYQT-EL-IVRLGEID-GTLQNSSKLQY 94

  Fly   144 -DYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLA 207
             :..||..:.|..|......::|.|::|..:||:.....|.|            |.|..|....|
  Fly    95 EEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPIC------------IDVNVGKVPKA 147

  Fly   208 LKPSAQLLKVK-----------LQRYGNWVCKKLLTRQVEEFPR------------GFDGNNQLC 249
              |:.::.|.|           ::|:.||.......|:    ||            |:....|: 
  Fly   148 --PTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGVRE----PRPDVILPPQPIAVGWPLTKQI- 205

  Fly   250 VGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
              :|.|             ::|:        .||.|   ...|.....:||.|..|:.||
  Fly   206 --NESA-------------LFHQ--------YGILS---HRNSESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 65/255 (25%)
Tryp_SPc 68..309 CDD:214473 63/253 (25%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.