DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and LOC101886682

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:279 Identity:82/279 - (29%)
Similarity:114/279 - (40%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLT 111
            |:|..:..:|:         .|..|..|:|...|:|..|      ...:...|||.|||:.||||
Zfish    15 LVPDLTFTARV---------GIEDGTEAKPHSRPYMVSL------QINSQHICGGSLISKEFVLT 64

  Fly   112 AAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVF 176
            ||||.:.:  :|..|..|..|   |.:.|....:.|..||.||.|......:||.|:||...|..
Zfish    65 AAHCWDKD--DVLTVVTGAHD---LRKKAIYNTFKVTSYIPHPDYNSYTLENDIMLLKLKTKVRL 124

  Fly   177 DLYKHPACLPFQ-DERSSDSFIAV-GWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVE--- 236
            ........||.. ::..:|:..:: |||               :|.|.|   .|....|:.|   
Zfish   125 SNSVGLISLPRNGEDLKADTLCSIAGWG---------------RLWRKG---AKTDRLREAETVI 171

  Fly   237 ----EFPRGFDGNNQLCVGSEMA-----QDTCNGDSGGPLLMYHREYPCMYVVVGIT--SAGLSC 290
                |..|.::.:   .|.|:|.     ..||:|||||||:       |....||||  |....|
Zfish   172 VNDAECERRWESD---YVASKMICAYGHGGTCSGDSGGPLV-------CNNTAVGITAFSDRYLC 226

  Fly   291 GSPGIPGIYTRVYPYLGWI 309
            .|...|.::.|:..||.||
Zfish   227 KSRLFPDVFARISAYLPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 79/258 (31%)
Tryp_SPc 68..309 CDD:214473 77/256 (30%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 79/258 (31%)
Tryp_SPc 27..245 CDD:214473 77/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.