DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and LOC101733035

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031749230.1 Gene:LOC101733035 / 101733035 -ID:- Length:216 Species:Xenopus tropicalis


Alignment Length:169 Identity:37/169 - (21%)
Similarity:65/169 - (38%) Gaps:51/169 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 VAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPS 211
            |:..|.|..|..|.:|::|.|::|:.    |..:    |||                    :...
 Frog    34 VSRTIIHDRYIYPVYYYNIALLELST----DSNQ----LPF--------------------ILQE 70

  Fly   212 AQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDT--CNGDSGGPLLMYHREY 274
            :::..:.|:|     |:.|..   |.:......:...| ..::.::|  ..||.||||:      
 Frog    71 SEVQLISLER-----CRDLYR---EAYTNILIADTMTC-AMDIHENTGISTGDLGGPLV------ 120

  Fly   275 PC----MYVVVGITSAGLSCGSPGIPGIYTRVYPYLGWI 309
             |    .:.:||:.|..:.. ...:|..||.|..|:.||
 Frog   121 -CQKGGQWFLVGVVSLEVIL-ELTLPVSYTSVPAYMDWI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 37/169 (22%)
Tryp_SPc 68..309 CDD:214473 35/167 (21%)
LOC101733035XP_031749230.1 Tryp_SPc <19..160 CDD:419748 37/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.