DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and XB5962685

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002941155.3 Gene:XB5962685 / 100496550 XenbaseID:XB-GENE-5962686 Length:251 Species:Xenopus tropicalis


Alignment Length:265 Identity:66/265 - (24%)
Similarity:113/265 - (42%) Gaps:51/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TPL-----IVGGHPAQP--REFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGE 122
            ||:     |.||..|.|  |.:..:.|.|..         .|||.||.:.:|||||.|   :...
 Frog    15 TPICAGMGITGGKEAIPHARRYMALVRTGSN---------LCGGTLIKDNWVLTAATC---KVDR 67

  Fly   123 VNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLP- 186
            ...|.||.....::::  ..:.:.||.::.|..::...:.:::.|::|:....|....:...|| 
 Frog    68 TTTVDLGVHSIKTMNK--LRQQFKVARWVPHQKFDRRSYVNNLQLLQLSSKANFSYAVNILLLPT 130

  Fly   187 -FQDERSSDSFIAVGWGSTGL-ALKPSAQLLKV------KLQRYGNWVCKKLLTRQVEEFPRGFD 243
             ::|.:........|||.|.. ..:.|.:|::|      ::|....|..|..:|:          
 Frog   131 KYKDIKPGTVCETAGWGITAYNGKQQSDKLMEVSLTVLDRMQCNNQWKSKIKITK---------- 185

  Fly   244 GNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAG-LSCGSPGIPGIYTRVYP-YL 306
              :.:|...:..:..||||.||||:       |..::.|:.|.| |.||......:|||:.. |:
 Frog   186 --DMMCTRDKGKRGFCNGDGGGPLI-------CNRILTGVISFGPLICGMENGANVYTRLTSNYI 241

  Fly   307 GWIAR 311
            .||.:
 Frog   242 KWIKK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 64/257 (25%)
Tryp_SPc 68..309 CDD:214473 62/253 (25%)
XB5962685XP_002941155.3 Tryp_SPc 23..246 CDD:238113 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.