DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and gzma

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:250 Identity:82/250 - (32%)
Similarity:109/250 - (43%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVLTAAHCLESERGEVNVVRLGELD 132
            |:.|..|.....|:||.:..|...       |||.||.:.:|||||||:.:.    :.|.||...
 Frog    35 IIDGREAASHSRPYMAYIYSRTGS-------CGGTLIKQNWVLTAAHCVVNN----SEVILGAHK 88

  Fly   133 FDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPF--QDERSSDS 195
            ..|.:.:  .:.:.||..|.||.:|..:..|||.|:::..|...:.:.....||.  .|.:...|
 Frog    89 VKSRENE--QQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPTTDMDVKPGSS 151

  Fly   196 FIAVGWGSTGLALK-PSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVG----SEMA 255
            ....|||.|....| ||..|.:|.:.......|.|:..:...|.     ..|.||.|    |:..
 Frog   152 CSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIYKKFKTEI-----STNMLCAGAPKKSDKK 211

  Fly   256 QDTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRVYP-YLGWI 309
            .|.|.|||||||:       |.....||.|.|..||.|..||||||:.. ||.||
 Frog   212 YDACQGDSGGPLI-------CGKEFSGIVSFGKKCGDPKYPGIYTRLTARYLQWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 81/249 (33%)
Tryp_SPc 68..309 CDD:214473 80/248 (32%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.