DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11843 and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:268 Identity:77/268 - (28%)
Similarity:123/268 - (45%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRRPDPSSRADWFCGGVLISERFVL 110
            :|||..::::.:...       ||.|:.|:|...|:|..:      .......|||.|:||:||:
Zfish    10 YLLPNLTLQASVKSG-------IVNGNEARPHSRPYMVSV------QCNRKHICGGFLVSEQFVM 61

  Fly   111 TAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVV 175
            |||||..:.: |:.|| :|..::    .|.|.| ..|..|..|||:|.....:||.|::|.:.|.
Zfish    62 TAAHCFVNGK-ELTVV-VGAHEY----TDGASR-MDVKFYHIHPGFESKTLLNDIMLLQLHKKVK 119

  Fly   176 FDLYKHPACLPFQDE--RSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEF 238
            .....:...:|..|:  ::.......|||......:.||:|::|.:..:....|:|.       :
Zfish   120 KSNKVNWIPIPNADKDIKAKTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKACQKY-------W 177

  Fly   239 PRGFDGNNQLCVGSEMAQDTCNGDSGGPLLMYHREYPCMYVVVGITSAG--LSCGSPGIPGIYTR 301
            ...:..:..:|.|..  ...|.|||||||:       |..|.|||.|..  .:|.||..|.:||:
Zfish   178 GPTYSTSKMMCTGGH--GGFCQGDSGGPLV-------CDKVAVGIVSFNEKNNCDSPTKPNVYTQ 233

  Fly   302 VYPYLGWI 309
            :..:|.||
Zfish   234 ISKFLSWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 74/246 (30%)
Tryp_SPc 68..309 CDD:214473 72/244 (30%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.