DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and gzma

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:279 Identity:79/279 - (28%)
Similarity:118/279 - (42%) Gaps:49/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 FSFLIENAPIIYKTLDKCTSYAPLIIGGGPAVPKEFPHAARL----GHKDENGEVEWFCGGTLIS 109
            |.||:       .|..|.|..:.:.|.||..|.|.......:    .||         |||.||.
Zfish    10 FHFLV-------FTFFKVTVCSDVSIVGGKDVKKALSWMVSIQVNQNHK---------CGGILIH 58

  Fly   110 DRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPE-FSYPAIYNDISVVR 173
            ...|||||||......||.:. :|.|.....:......::::      || |:.....:||.::|
Zfish    59 KEWVLTAAHCKEDSYSSVTVL-IGSLSLSKGSQRIAIHNYEI------PETFNKKTKKDDIMLIR 116

  Fly   174 LSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVK-LYNYGTRCRITADR 237
            ||:.|....||.|.  ...|.:.||..:..|||..:...:..:.|||.:: |.....:|....:|
Zfish   117 LSKKVKAKPYKIPK--KEKDVQPGTKCVVRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNR 179

  Fly   238 NDELPEGYNATTQLCIG-SNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAM 301
            |..:.:     ..||.| :.:|:.||.||||||:       .|..:::|:.|....|..|..|.:
Zfish   180 NPVITK-----DMLCAGNTQQHRGTCLGDSGGPL-------ECEKNLVGVLSGSHGCGDPKKPTV 232

  Fly   302 YTRV-HFYLDWI----KQQ 315
            ||.: ..::.||    |||
Zfish   233 YTLLSKRHITWINKILKQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 71/253 (28%)
Tryp_SPc 73..312 CDD:214473 68/246 (28%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.