DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11842 and F12

DIOPT Version :9

Sequence 1:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster
Sequence 2:NP_067464.2 Gene:F12 / 58992 MGIID:1891012 Length:597 Species:Mus musculus


Alignment Length:261 Identity:73/261 - (27%)
Similarity:108/261 - (41%) Gaps:35/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEW---FCGGTLISDRHVLTAAHC-HYSPQGSVNIARLG 133
            ::||..|:|...|:.|.|         .|   ||.|:||:...||||||| ...|........||
Mouse   355 VVGGLVALPGSHPYIAAL---------YWGNNFCAGSLIAPCWVLTAAHCLQNRPAPEELTVVLG 410

  Fly   134 DLEFDTNNDDAD-PEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVT-----FNDYKHPACLPFD 192
            .   |.:|...: .:...|:.:..|..||.....:|::::||....|     .:.:..|.|||  
Mouse   411 Q---DRHNQSCEWCQTLAVRSYRLHEGFSSITYQHDLALLRLQESKTNSCAILSPHVQPVCLP-- 470

  Fly   193 DGRLGTSFIAI----GWGQLEIVPRTENKKLQKVKL-YNYGTRCRITADRNDELPEGYNATTQLC 252
            .|....|...:    |||.........:..||:.:: :....||..:....|.:..|     .||
Mouse   471 SGAAPPSETVLCEVAGWGHQFEGAEEYSTFLQEAQVPFIALDRCSNSNVHGDAILPG-----MLC 530

  Fly   253 IGSNE-HKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQL 316
            .|..| ..|.|.||||||::...........:.|:.|.|..|...:.|.:||.|..||.||::.:
Mouse   531 AGFLEGGTDACQGDSGGPLVCEEGTAEHQLTLRGVISWGSGCGDRNKPGVYTDVANYLAWIQKHI 595

  Fly   317 A 317
            |
Mouse   596 A 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 72/257 (28%)
Tryp_SPc 73..312 CDD:214473 70/254 (28%)
F12NP_067464.2 FN2 41..88 CDD:238019
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
KR 217..295 CDD:294073
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..338
Tryp_SPc 354..591 CDD:214473 70/254 (28%)
Tryp_SPc 355..594 CDD:238113 72/257 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.